Structure of PDB 5n91 Chain A Binding Site BS02

Receptor Information
>5n91 Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRV
VGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDAN
VFASAMMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n91 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution1.49 Å
Binding residue
(original residue number in PDB)
Y38 R47 V58 N61
Binding residue
(residue number reindexed from 1)
Y40 R49 V60 N63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5n91, PDBe:5n91, PDBj:5n91
PDBsum5n91
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]