Structure of PDB 5n89 Chain A Binding Site BS02

Receptor Information
>5n89 Chain A (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSA
PATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG
TTEANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n89 Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution1.27 Å
Binding residue
(original residue number in PDB)
L25 S45 A46 W79 R84 N85
Binding residue
(residue number reindexed from 1)
L12 S32 A33 W66 R71 N72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5n89, PDBe:5n89, PDBj:5n89
PDBsum5n89
PubMed28935886
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]