Structure of PDB 5mwe Chain A Binding Site BS02

Receptor Information
>5mwe Chain A (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQIL
KTHNVLRNV
Ligand information
>5mwe Chain D (length=27) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RLECIDVCSVLTNRLEELAGFLNSLLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mwe Structural Basis for Mitotic Centrosome Assembly in Flies.
Resolution2.02 Å
Binding residue
(original residue number in PDB)		E1123 I1126 I1130 T1133 L1137
Binding residue
(residue number reindexed from 1)		E42 I45 I49 T52 L56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5mwe, PDBe:5mwe, PDBj:5mwe
PDBsum5mwe
PubMed28575671
UniProtP54623|CNN_DROME Centrosomin (Gene Name=cnn)

[Back to BioLiP]