Structure of PDB 5mtw Chain A Binding Site BS02

Receptor Information
>5mtw Chain A (length=138) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLDLQRVGARLAARAQIRDIRLLRTQAAVHRAPKQGLTYDLEFEPAVDAD
PATISAFVVRISCHLRIQNQADVATADFEFAALFDYHLQEGEDDPTEEEL
TAYAATTGRFALYPYIREYVYDLTGRLALPPLTLEILS
Ligand information
>5mtw Chain G (length=12) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EVPTWHRLSSYR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mtw Structural insights into chaperone addiction of toxin-antitoxin systems.
Resolution1.84 Å
Binding residue
(original residue number in PDB)
L47 P155 P156 L157
Binding residue
(residue number reindexed from 1)
L37 P130 P131 L132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009274 peptidoglycan-based cell wall

View graph for
Cellular Component
External links
PDB RCSB:5mtw, PDBe:5mtw, PDBj:5mtw
PDBsum5mtw
PubMed30770830
UniProtP95257|SECBL_MYCTU SecB-like chaperone Rv1957 (Gene Name=secBL)

[Back to BioLiP]