Structure of PDB 5m6l Chain A Binding Site BS02

Receptor Information

>5m6l Chain A (length=105) Species: 9606 (Homo sapiens)

MNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDK
VKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHS
LEECL

Ligand information

• Ligand ID: 7H9
• InChI: InChI=1S/C29H40FN5O2/c1-20-15-34(25(14-31-20)16-33-9-10-37-18-21(33)2)17-27(36)35-19-29(3,4)28-26(35)12-23(13-32-28)11-22-5-7-24(30)8-6-22/h5-8,12-13,20-21,25,31H,9-11,14-19H2,1-4H3/p+1/t20-,21-,25-/m1/s1
• InChIKey: XIQKDUKFFKQZAO-DNRQZRRGSA-O
• SMILES:
  OpenEye OEToolkits 2.0.6: CC1CN(C(C[NH2+]1)CN2CCOCC2C)CC(=O)N3CC(c4c3cc(cn4)Cc5ccc(cc5)F)(C)C
  CACTVS 3.385: C[C@@H]1CN(CC(=O)N2CC(C)(C)c3ncc(Cc4ccc(F)cc4)cc23)[C@H](C[NH2+]1)CN5CCOC[C@H]5C
  CACTVS 3.385: C[CH]1CN(CC(=O)N2CC(C)(C)c3ncc(Cc4ccc(F)cc4)cc23)[CH](C[NH2+]1)CN5CCOC[CH]5C
  OpenEye OEToolkits 2.0.6: C[C@@H]1CN([C@H](C[NH2+]1)CN2CCOC[C@H]2C)CC(=O)N3CC(c4c3cc(cn4)Cc5ccc(cc5)F)(C)C
• Formula: C29 H41 F N5 O2
• Name: 1-[6-[(4-fluorophenyl)methyl]-3,3-dimethyl-2~{H}-pyrrolo[3,2-b]pyridin-1-yl]-2-[(2~{R},5~{R})-5-methyl-2-[[(3~{R})-3-methylmorpholin-4-yl]methyl]piperazin-4-ium-1-yl]ethanone
• PDB chain: 5m6l Chain A Residue 403

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5m6l Discovery of a Potent Nonpeptidomimetic, Small-Molecule Antagonist of Cellular Inhibitor of Apoptosis Protein 1 (cIAP1) and X-Linked Inhibitor of Apoptosis Protein (XIAP).
• Resolution: 2.61 Å
• Binding residue (original residue number in PDB): L292 K297 G306 L307 T308 D309 W310 K311 E314 Q319 W323
• Binding residue (residue number reindexed from 1): L45 K50 G59 L60 T61 D62 W63 K64 E67 Q72 W76
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

External links

• PDB: RCSB:5m6l, PDBe:5m6l, PDBj:5m6l
• PDBsum: 5m6l
• PubMed: 28492317
• UniProt: P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP)