Structure of PDB 5m6e Chain A Binding Site BS02

Receptor Information

>5m6e Chain A (length=106) Species: 9606 (Homo sapiens)

MNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDK
VKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHS
LEECLV

Ligand information

• Ligand ID: 7HT
• InChI: InChI=1S/C28H36N6O/c1-20-12-31-33(15-20)17-24-13-29-21(2)16-32(24)18-27(35)34-19-28(3,4)25-14-30-23(11-26(25)34)10-22-8-6-5-7-9-22/h5-9,11-12,14-15,21,24,29H,10,13,16-19H2,1-4H3/p+1/t21-,24-/m1/s1
• InChIKey: CLHWAAAYYHMVJX-ZJSXRUAMSA-O
• SMILES:
  CACTVS 3.385: C[CH]1CN(CC(=O)N2CC(C)(C)c3cnc(Cc4ccccc4)cc23)[CH](C[NH2+]1)Cn5cc(C)cn5
  CACTVS 3.385: C[C@@H]1CN(CC(=O)N2CC(C)(C)c3cnc(Cc4ccccc4)cc23)[C@H](C[NH2+]1)Cn5cc(C)cn5
  OpenEye OEToolkits 2.0.6: Cc1cnn(c1)CC2C[NH2+]C(CN2CC(=O)N3CC(c4c3cc(nc4)Cc5ccccc5)(C)C)C
  OpenEye OEToolkits 2.0.6: Cc1cnn(c1)C[C@H]2C[NH2+][C@@H](CN2CC(=O)N3CC(c4c3cc(nc4)Cc5ccccc5)(C)C)C
• Formula: C28 H37 N6 O
• Name: 1-[3,3-dimethyl-6-(phenylmethyl)-2~{H}-pyrrolo[3,2-c]pyridin-1-yl]-2-[(2~{R},5~{R})-5-methyl-2-[(4-methylpyrazol-1-yl)methyl]piperazin-4-ium-1-yl]ethanone
• PDB chain: 5m6e Chain A Residue 404

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5m6e Discovery of a Potent Nonpeptidomimetic, Small-Molecule Antagonist of Cellular Inhibitor of Apoptosis Protein 1 (cIAP1) and X-Linked Inhibitor of Apoptosis Protein (XIAP).
• Resolution: 2.32 Å
• Binding residue (original residue number in PDB): K297 G306 L307 T308 D309 W310 E314 Q319 W323
• Binding residue (residue number reindexed from 1): K50 G59 L60 T61 D62 W63 E67 Q72 W76
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

External links

• PDB: RCSB:5m6e, PDBe:5m6e, PDBj:5m6e
• PDBsum: 5m6e
• PubMed: 28492317
• UniProt: P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP)