Structure of PDB 5m0j Chain A Binding Site BS02

Receptor Information

>5m0j Chain A (length=223) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTL
IKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLN
YYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRI
GSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILD
GKLSALDEEFDVVATKWHDKFGK

Ligand information

>5m0j Chain H (length=22) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NKRRSFYTASPSPVLPGVKRTA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5m0j Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	I56 K57
Binding residue (residue number reindexed from 1)	I51 K52

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0008289	lipid binding
GO:1990825	sequence-specific mRNA binding

	Biological Process
GO:0007533	mating type switching
GO:0008298	intracellular mRNA localization
GO:0051028	mRNA transport

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005934	cellular bud tip

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m0j, PDBe:5m0j, PDBj:5m0j
PDBsum	5m0j
PubMed	28092367
UniProt	P36068\|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2); P38272\|SHE3_YEAST SWI5-dependent HO expression protein 3 (Gene Name=SHE3)

[Back to BioLiP]