Structure of PDB 5lxu Chain A Binding Site BS02

Receptor Information
>5lxu Chain A (length=57) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQ
KYRLYLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lxu Structure of the DNA-binding domain of LUX ARRHYTHMO
Resolution2.14 Å
Binding residue
(original residue number in PDB)		R146 L147 W149 N187 S190 K194
Binding residue
(residue number reindexed from 1)		R3 L4 W6 N44 S47 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5lxu, PDBe:5lxu, PDBj:5lxu
PDBsum5lxu
PubMed
UniProtQ9SNB4|PCL1_ARATH Transcription factor LUX (Gene Name=LUX)

[Back to BioLiP]