Structure of PDB 5l0m Chain A Binding Site BS02

Receptor Information
>5l0m Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDK
TQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l0m A Structural Investigation into Oct4 Regulation by Orphan Nuclear Receptors, Germ Cell Nuclear Factor (GCNF), and Liver Receptor Homolog-1 (LRH-1).
Resolution2.197 Å
Binding residue
(original residue number in PDB)		Y96 H97 Y98 K107 K111 V156 R157 R160 M161 R162 R165 N166 Y172
Binding residue
(residue number reindexed from 1)		Y14 H15 Y16 K25 K29 V74 R75 R78 M79 R80 R83 N84 Y90
Binding affinityPDBbind-CN: Kd=60nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5l0m, PDBe:5l0m, PDBj:5l0m
PDBsum5l0m
PubMed27984042
UniProtO00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]