Structure of PDB 5kl5 Chain A Binding Site BS02

Receptor Information
>5kl5 Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kl5 Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
Resolution2.289 Å
Binding residue
(original residue number in PDB)		R366 D368 D396 K399 D426
Binding residue
(residue number reindexed from 1)		R18 D20 D48 K51 D78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kl5, PDBe:5kl5, PDBj:5kl5
PDBsum5kl5
PubMed27596598
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]