Structure of PDB 5kl3 Chain A Binding Site BS02

Receptor Information
>5kl3 Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKT
HTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kl3 Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
Resolution1.449 Å
Binding residue
(original residue number in PDB)		S395 D396 S425
Binding residue
(residue number reindexed from 1)		S45 D46 S75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kl3, PDBe:5kl3, PDBj:5kl3
PDBsum5kl3
PubMed27596598
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]