Structure of PDB 5kkq Chain A Binding Site BS02

Receptor Information
>5kkq Chain A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKL
KRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARF
TQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kkq Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution1.744 Å
Binding residue
(original residue number in PDB)		F331 E336 R339 H340 Y343 K344 Y358 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 T400 K405 F416 T417 Q418 T421 H425 K429 I446 A447 R448 D451
Binding residue
(residue number reindexed from 1)		F15 E20 R23 H24 Y27 K28 Y42 E46 K49 R52 H53 S56 R61 Y70 R73 K77 R80 H81 T84 K89 F100 T101 Q102 T105 H109 K113 I130 A131 R132 D135
Binding affinityPDBbind-CN: Kd=9nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kkq, PDBe:5kkq, PDBj:5kkq
PDBsum5kkq
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]