Structure of PDB 5ke8 Chain A Binding Site BS02

Receptor Information
>5ke8 Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDPLT
RHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ke8 Distinctive Klf4 mutants determine preference for DNA methylation status.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
S444 F460 S472
Binding residue
(residue number reindexed from 1)
S46 F62 S74
Binding affinityPDBbind-CN: Kd<2.3nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ke8, PDBe:5ke8, PDBj:5ke8
PDBsum5ke8
PubMed27596594
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]