Structure of PDB 5ke6 Chain A Binding Site BS02

Receptor Information
>5ke6 Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELT
RHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ke6 Distinctive Klf4 mutants determine preference for DNA methylation status.
Resolution1.99 Å
Binding residue
(original residue number in PDB)
K413 S415 Y430 D445 S472
Binding residue
(residue number reindexed from 1)
K15 S17 Y32 D47 S74
Binding affinityPDBbind-CN: Kd=0.19uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ke6, PDBe:5ke6, PDBj:5ke6
PDBsum5ke6
PubMed27596594
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]