Structure of PDB 5k5j Chain A Binding Site BS02

Receptor Information
>5k5j Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMH
ILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAV
FHERYALIQHQKSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5j Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution2.287 Å
Binding residue
(original residue number in PDB)		Y386 K393 R396 H397 T400 K405 F416 T417 Q418 T421 H425 K429 I446 A447 R448 D451 H455 Q459 R479
Binding residue
(residue number reindexed from 1)		Y11 K18 R21 H22 T25 K30 F41 T42 Q43 T46 H50 K54 I71 A72 R73 D76 H80 Q84 R104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5j, PDBe:5k5j, PDBj:5k5j
PDBsum5k5j
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]