Structure of PDB 5k5i Chain A Binding Site BS02

Receptor Information
>5k5i Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHI
LQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVF
HERYALIQHQKSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5i Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		Y386 K393 R396 H397 T400 F416 Q418 T421 H425 R448 D451 H455 Q459 R479
Binding residue
(residue number reindexed from 1)		Y10 K17 R20 H21 T24 F40 Q42 T45 H49 R72 D75 H79 Q83 R103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5i, PDBe:5k5i, PDBj:5k5i
PDBsum5k5i
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]