Structure of PDB 5k5h Chain A Binding Site BS02

Receptor Information
>5k5h Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMR
THSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARK
SDLGVHLRKQH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5h Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution3.108 Å
Binding residue
(original residue number in PDB)
Y392 K395 Y407 S419 K423 K449 S450 R457
Binding residue
(residue number reindexed from 1)
Y43 K46 Y58 S70 K74 K100 S101 R108
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5h, PDBe:5k5h, PDBj:5k5h
PDBsum5k5h
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]