Structure of PDB 5jxy Chain A Binding Site BS02

Receptor Information
>5jxy Chain A (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW
KCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFRE
GGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIP
DTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jxy Structural basis of damage recognition by thymine DNA glycosylase: Key roles for N-terminal residues.
Resolution1.71 Å
Binding residue
(original residue number in PDB)		G138 I139 N140 G142 Y152 G156 N157 N191 S200 K201 G231 K232 C233 P270 S271 S273 A274 R275 C276 Q278
Binding residue
(residue number reindexed from 1)		G28 I29 N30 G32 Y42 G46 N47 N81 S90 K91 G121 K122 C123 P160 S161 S163 A164 R165 C166 Q168
Enzymatic activity
Catalytic site (original residue number in PDB) N140 H151
Catalytic site (residue number reindexed from 1) N30 H41
Enzyme Commision number 3.2.2.29: thymine-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0000700 mismatch base pair DNA N-glycosylase activity
Biological Process
GO:0006285 base-excision repair, AP site formation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5jxy, PDBe:5jxy, PDBj:5jxy
PDBsum5jxy
PubMed27580719
UniProtQ13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)

[Back to BioLiP]