Structure of PDB 5j2y Chain A Binding Site BS02

Receptor Information
>5j2y Chain A (length=70) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQPQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYL
LLHFYIEGQITDRQLADLRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j2y Molecular insight into the regulatory mechanism of the quorum-sensing repressor RsaL in Pseudomonas aeruginosa
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S37 S39
Binding residue
(residue number reindexed from 1)		S31 S33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5j2y, PDBe:5j2y, PDBj:5j2y
PDBsum5j2y
PubMed27924027
UniProtQ9X7H4

[Back to BioLiP]