Structure of PDB 5iqo Chain A Binding Site BS02

Receptor Information
>5iqo Chain A (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVT
ASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQS
AHFPLQVRALTVNGGATQGTIEAVIEITYTYS
Ligand information
>5iqo Chain D (length=13) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADSRIRIRGYVRN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iqo Accelerating the Association of the Most Stable Protein-Ligand Complex by More than Two Orders of Magnitude.
Resolution1.302 Å
Binding residue
(original residue number in PDB)		E50 S112 H114
Binding residue
(residue number reindexed from 1)		E38 S100 H102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007155 cell adhesion
GO:0007638 mechanosensory behavior
GO:0031589 cell-substrate adhesion
GO:0043709 cell adhesion involved in single-species biofilm formation
Cellular Component
GO:0009289 pilus
GO:0009419 pilus tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5iqo, PDBe:5iqo, PDBj:5iqo
PDBsum5iqo
PubMed27351462
UniProtP08190|FIMG_ECOLI Protein FimG (Gene Name=fimG)

[Back to BioLiP]