Structure of PDB 5i50 Chain A Binding Site BS02

Receptor Information

>5i50 Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MATEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILK
KATAYILSVQAETQKLISEIDLLRKQNEQLKHKLEQLRNSCA

Ligand information

>5i50 Chain D (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtgtaggccacgtgaccgggtg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5i50 OmoMYC blunts promoter invasion by oncogenic MYC to inhibit gene expression characteristic of MYC-dependent tumors.
Resolution	2.701 Å
Binding residue (original residue number in PDB)	R9 H12 N13 E16 R17 R20 K24 P44 K45
Binding residue (residue number reindexed from 1)	R9 H12 N13 E16 R17 R20 K24 P44 K45
Binding affinity	PDBbind-CN: Kd=391nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5i50, PDBe:5i50, PDBj:5i50
PDBsum	5i50
PubMed	27748763
UniProt	P01106\|MYC_HUMAN Myc proto-oncogene protein (Gene Name=MYC)

[Back to BioLiP]