Structure of PDB 5hnf Chain A Binding Site BS02

Receptor Information
>5hnf Chain A (length=280) Species: 1408 (Bacillus pumilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNR
LIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSD
QPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNN
NIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGK
ETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKP
EFNAYKYDFTSEDDKKSFFKDWQQYYSNVN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hnf Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
Resolution1.546 Å
Binding residue
(original residue number in PDB)		R15 G16 K17 K19 N20 T61 K63 T64 N67 H68 K121 L122 Q208 R211
Binding residue
(residue number reindexed from 1)		R14 G15 K16 K18 N19 T60 K62 T63 N66 H67 K120 L121 Q207 R210
Enzymatic activity
Enzyme Commision number ?
External links