Structure of PDB 5hlh Chain A Binding Site BS02

Receptor Information
>5hlh Chain A (length=135) Species: 1282 (Staphylococcus epidermidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENP
QTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNG
QQQQEAVFEAISSCYDETKYVFEELEQTLKHLIEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hlh Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
T37 Y38 S39 Q40 N67 T68 M72 R75 K91
Binding residue
(residue number reindexed from 1)
T35 Y36 S37 Q38 N65 T66 M70 R73 K89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5hlh, PDBe:5hlh, PDBj:5hlh
PDBsum5hlh
PubMed28086264
UniProtQ5HKZ1

[Back to BioLiP]