Structure of PDB 5haw Chain A Binding Site BS02

Receptor Information
>5haw Chain A (length=186) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
INRREEILQALAEMLESNEGASRITTAKLAKQVGVSEAALYRHFPSKTRM
FEGLIEFIEESLMSRINRIFDEEKDTLNRIRLVMQLLLAFAERNPGLTRI
LSGHALMFENERLRDRINQLFERIETSLRQILRERKKSFPVDENILAAQL
LGQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5haw Structures of the nucleoid occlusion protein SlmA bound to DNA and the C-terminal domain of the cytoskeletal protein FtsZ.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		L14 Q15 A18 E22 L60 F63 S67 R71 R74 I75 R87 L88 Q91 A95 F96 R99 N100
Binding residue
(residue number reindexed from 1)		L8 Q9 A12 E16 L54 F57 S61 R65 R68 I69 R81 L82 Q85 A89 F90 R93 N94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010974 negative regulation of division septum assembly
GO:0051301 cell division
GO:0051302 regulation of cell division
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid
GO:0043590 bacterial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5haw, PDBe:5haw, PDBj:5haw
PDBsum5haw
PubMed27091999
UniProtQ9KVD2|SLMA_VIBCH Nucleoid occlusion factor SlmA (Gene Name=slmA)

[Back to BioLiP]