Structure of PDB 5gzb Chain A Binding Site BS02

Receptor Information
>5gzb Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGK
TRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gzb DNA-binding mechanism of the Hippo pathway transcription factor TEAD4
Resolution2.704 Å
Binding residue
(original residue number in PDB)		K65 I66 M74 G76 N78 E79 R95 K96 Q103
Binding residue
(residue number reindexed from 1)		K24 I25 M33 G35 N37 E38 R54 K55 Q62
Binding affinityPDBbind-CN: Kd=0.23uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5gzb, PDBe:5gzb, PDBj:5gzb
PDBsum5gzb
PubMed28368398
UniProtQ15561|TEAD4_HUMAN Transcriptional enhancer factor TEF-3 (Gene Name=TEAD4)

[Back to BioLiP]