Structure of PDB 5gke Chain A Binding Site BS02

Receptor Information
>5gke Chain A (length=239) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGS
GDRVIIVKPDGSFLIHQSKKREPVNWQPPGSRVRLELRENPVLVSIRRKP
RETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFK
PLFREKAIGTGIVAVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILR
EEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gke Structure of the EndoMS-DNA Complex as Mismatch Restriction Endonuclease
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y41 R44 N76 W77 Q78 E103 R184 R191 T218 S219 G220
Binding residue
(residue number reindexed from 1)		Y40 R43 N75 W76 Q77 E102 R183 R190 T217 S218 G219
Binding affinityPDBbind-CN: Kd=3.4nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0006259 DNA metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gke, PDBe:5gke, PDBj:5gke
PDBsum5gke
PubMed27773688
UniProtQ5JER9|NUCS_THEKO Endonuclease NucS (Gene Name=nucS)

[Back to BioLiP]