Structure of PDB 5g3z Chain A Binding Site BS02

Receptor Information

>5g3z Chain A (length=215) Species: 32630 (synthetic construct)

MNLVLMGLPGAGKGTQAEKIVEKYGIPHISTGDMFRAAIKEGTELGLKAK
SFMDKGELVPDEVTIGIVRERLSKDDCKKGFLLDGFPRTVAQAEALDNIL
KELGKKLDYVINIEVPKEELMERLTGRRICKTCGATYHLIFNPPKVEGVC
DKCGGELYQRADDNEETVANRLDVNMKQTQPLLDFYEEKGYLRNIDGQQD
INKVFADIDALLGGL

Ligand information

• Ligand ID: AP5
• InChI: InChI=1S/C20H29N10O22P5/c21-15-9-17(25-3-23-15)29(5-27-9)19-13(33)11(31)7(47-19)1-45-53(35,36)49-55(39,40)51-57(43,44)52-56(41,42)50-54(37,38)46-2-8-12(32)14(34)20(48-8)30-6-28-10-16(22)24-4-26-18(10)30/h3-8,11-14,19-20,31-34H,1-2H2,(H,35,36)(H,37,38)(H,39,40)(H,41,42)(H,43,44)(H2,21,23,25)(H2,22,24,26)/t7-,8-,11-,12-,13-,14-,19-,20-/m1/s1
• InChIKey: OIMACDRJUANHTJ-XPWFQUROSA-N
• SMILES:
  OpenEye OEToolkits 1.5.0: c1nc(c2c(n1)n(cn2)C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OCC4C(C(C(O4)n5cnc6c5ncnc6N)O)O)O)O)N
  CACTVS 3.341: Nc1ncnc2n(cnc12)[C@@H]3O[C@H](CO[P@@](O)(=O)O[P@@](O)(=O)O[P@](O)(=O)O[P@](O)(=O)O[P@](O)(=O)OC[C@H]4O[C@H]([C@H](O)[C@@H]4O)n5cnc6c(N)ncnc56)[C@@H](O)[C@H]3O
  OpenEye OEToolkits 1.5.0: c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O)(O)O[P@](=O)(O)OP(=O)(O)O[P@@](=O)(O)O[P@@](=O)(O)OC[C@@H]4[C@H]([C@H]([C@@H](O4)n5cnc6c5ncnc6N)O)O)O)O)N
  CACTVS 3.341: Nc1ncnc2n(cnc12)[CH]3O[CH](CO[P](O)(=O)O[P](O)(=O)O[P](O)(=O)O[P](O)(=O)O[P](O)(=O)OC[CH]4O[CH]([CH](O)[CH]4O)n5cnc6c(N)ncnc56)[CH](O)[CH]3O
• Formula: C20 H29 N10 O22 P5
• Name: BIS(ADENOSINE)-5'-PENTAPHOSPHATE
• ChEMBL: CHEMBL437508
• DrugBank: DB01717
• ZINC: ZINC000096085195
• PDB chain: 5g3z Chain A Residue 1217

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5g3z Evolutionary drivers of thermoadaptation in enzyme catalysis.
• Resolution: 1.89 Å
• Binding residue (original residue number in PDB): P9 G10 G12 K13 G14 T15 T31 R36 M53 E57 V59 T64 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201
• Binding residue (residue number reindexed from 1): P9 G10 G12 K13 G14 T15 T31 R36 M53 E57 V59 T64 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 17:23:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5g3z', asym_id = 'A', bs = 'BS02', title = 'Evolutionary drivers of thermoadaptation in enzyme catalysis.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5g3z', asym_id='A', bs='BS02', title='Evolutionary drivers of thermoadaptation in enzyme catalysis.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004017,0005524,0006139,0016776,0019205', uniprot = '', pdbid = '5g3z', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004017,0005524,0006139,0016776,0019205', uniprot='', pdbid='5g3z', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>