Structure of PDB 5fvk Chain A Binding Site BS02

Receptor Information
>5fvk Chain A (length=82) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNP
KSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Ligand information
>5fvk Chain D (length=19) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YSNTDPEELLRKHVFPSVP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fvk Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
Resolution1.658 Å
Binding residue
(original residue number in PDB)		K51 L55 K59
Binding residue
(residue number reindexed from 1)		K51 L55 K59
Enzymatic activity
Enzyme Commision number 3.6.4.6: vesicle-fusing ATPase.
External links
PDB RCSB:5fvk, PDBe:5fvk, PDBj:5fvk
PDBsum5fvk
PubMed27075672
UniProtP52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]