Structure of PDB 5fmp Chain A Binding Site BS02

Receptor Information
>5fmp Chain A (length=184) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPS
KVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPL
LTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARV
ISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fmp Kstr, Transcriptional Repressor of Cholesterol Degradation in Mycobacterium Tuberculosis
Resolution2.26 Å
Binding residue
(original residue number in PDB)		Q59 M60 R61 Y75 S80 K81
Binding residue
(residue number reindexed from 1)		Q29 M30 R31 Y45 S50 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5fmp, PDBe:5fmp, PDBj:5fmp
PDBsum5fmp
PubMed
UniProtP96856|KSTR_MYCTU HTH-type transcriptional repressor KstR (Gene Name=kstR)

[Back to BioLiP]