Structure of PDB 5f0q Chain A Binding Site BS02

Receptor Information
>5f0q Chain A (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KISLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLT
LEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLK
IILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTH
YQVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f0q Mechanism of Concerted RNA-DNA Primer Synthesis by the Human Primosome.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		H303 M307 K343 Y347 N348 H351 G357 K358 T360 Y362 T363 P364 F365 S366 K369 N442 H443
Binding residue
(residue number reindexed from 1)		H34 M38 K74 Y78 N79 H82 G88 K89 T91 Y93 T94 P95 F96 S97 K100 N173 H174
Enzymatic activity
Enzyme Commision number 2.7.7.-
Gene Ontology
Biological Process
GO:0006269 DNA replication, synthesis of primer

View graph for
Biological Process
External links
PDB RCSB:5f0q, PDBe:5f0q, PDBj:5f0q
PDBsum5f0q
PubMed26975377
UniProtP49643|PRI2_HUMAN DNA primase large subunit (Gene Name=PRIM2)

[Back to BioLiP]