Structure of PDB 5ego Chain A Binding Site BS02

Receptor Information
>5ego Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINAR
RRIVQPM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ego Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		Y299 I324 R327 R328
Binding residue
(residue number reindexed from 1)		Y22 I47 R50 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ego, PDBe:5ego, PDBj:5ego
PDBsum5ego
PubMed28473536
UniProtO00470|MEIS1_HUMAN Homeobox protein Meis1 (Gene Name=MEIS1)

[Back to BioLiP]