Structure of PDB 5eg0 Chain A Binding Site BS02

Receptor Information
>5eg0 Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARR
RIVQPM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eg0 Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
Resolution3.101 Å
Binding residue
(original residue number in PDB)
Y299 E302 K305 R327 R328
Binding residue
(residue number reindexed from 1)
Y21 E24 K27 R49 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5eg0, PDBe:5eg0, PDBj:5eg0
PDBsum5eg0
PubMed
UniProtO14770|MEIS2_HUMAN Homeobox protein Meis2 (Gene Name=MEIS2)

[Back to BioLiP]