Structure of PDB 5e69 Chain A Binding Site BS02

Receptor Information

>5e69 Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRYRKCLQAGMNLEA

Ligand information

>5e69 Chain D (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atcgtggaatttcctc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5e69 Cryptic glucocorticoid receptor-binding sites pervade genomic NF-kappa B response elements.
Resolution	1.85 Å
Binding residue (original residue number in PDB)	S440 F444 R447 R470 K471 R477
Binding residue (residue number reindexed from 1)	S23 F27 R30 R53 K54 R60
Binding affinity	PDBbind-CN: Kd=17uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5e69, PDBe:5e69, PDBj:5e69
PDBsum	5e69
PubMed	29626214
UniProt	P04150\|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]