Structure of PDB 5e01 Chain A Binding Site BS02

Receptor Information
>5e01 Chain A (length=126) Species: 71421 (Haemophilus influenzae Rd KW20) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTYTTAKAAEKIGISAYTLRFYDKEGLLPNVGRDEYGNRRFTDKDLQWLS
LLQCLKNTGMSLKDIKRFAECTIIGDDTIEERLSLFENQTKNVKCQIAEL
KRYLDLLEYKLAFYQKAKALGSVKAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e01 Structural basis of thiol-based regulation of formaldehyde detoxification in H. influenzae by a MerR regulator with no sensor region.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T5 R20 R33 N38 R39
Binding residue
(residue number reindexed from 1)		T5 R20 R33 N38 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5e01, PDBe:5e01, PDBj:5e01
PDBsum5e01
PubMed27307602
UniProtP44558|Y186_HAEIN Uncharacterized HTH-type transcriptional regulator HI_0186 (Gene Name=HI_0186)

[Back to BioLiP]