Structure of PDB 5dzd Chain A Binding Site BS02

Receptor Information

>5dzd Chain A (length=37) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS

Ligand information

>5dzd Chain D (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EAPPCYMDVI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5dzd Crystal Structure of WW4 domain of ITCH in complex with TXNIP peptide
Resolution	1.57 Å
Binding residue (original residue number in PDB)	R501 R502
Binding residue (residue number reindexed from 1)	R24 R25

Enzymatic activity

Enzyme Commision number

2.3.2.26: HECT-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:5dzd, PDBe:5dzd, PDBj:5dzd
PDBsum	5dzd
PubMed
UniProt	Q96J02\|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog (Gene Name=ITCH)

[Back to BioLiP]