Structure of PDB 5cpj Chain A Binding Site BS02

Receptor Information

>5cpj Chain A (length=94) Species: 9606 (Homo sapiens)

YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVM
ALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER

Ligand information

>5cpj Chain J (length=146)

atcagattccattcgaatccattcgaaaatgattacattcgaatccattc
gaagattccatttgagcctgttcgaaaattccatttgagtccaaccaatg
attccattcatttccattcaatgattccattcgaatccatttggat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5cpj Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
• Resolution: 3.15 Å
• Binding residue (original residue number in PDB): Y41 R42 G44 V46 R49 R63 K64 R69 R83
• Binding residue (residue number reindexed from 1): Y1 R2 G4 V6 R9 R23 K24 R29 R43

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:5cpj, PDBe:5cpj, PDBj:5cpj
• PDBsum: 5cpj
• PubMed: 26446621
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)