Structure of PDB 5co5 Chain A Binding Site BS02

Receptor Information
>5co5 Chain A (length=207) Species: 6500 (Aplysia californica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVD
LVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQV
LSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSG
FEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLV
VKFRERR
Ligand information
>5co5 Chain C (length=16) Species: 6491 (Conus geographus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GCCSHPACAGNNQHIC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5co5 Crystal structure of Ac-AChBP in complex with conotoxin GIC
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y53 R77 V106 T108 M114 I116 D162 S164
Binding residue
(residue number reindexed from 1)		Y54 R78 V107 T109 M115 I117 D163 S165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005230 extracellular ligand-gated monoatomic ion channel activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0034220 monoatomic ion transmembrane transport
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5co5, PDBe:5co5, PDBj:5co5
PDBsum5co5
PubMed
UniProtQ8WSF8

[Back to BioLiP]