Structure of PDB 5cc0 Chain A Binding Site BS02

Receptor Information

>5cc0 Chain A (length=73) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QKVCLICGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRLRKCLQAGMTLGA

Ligand information

>5cc0 Chain D (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agctctcccggaggcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5cc0 Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space.
Resolution	2.405 Å
Binding residue (original residue number in PDB)	G439 S440 F444 R447 R470 K471 R477
Binding residue (residue number reindexed from 1)	G22 S23 F27 R30 R53 K54 R60
Binding affinity	PDBbind-CN: Kd=0.369uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5cc0, PDBe:5cc0, PDBj:5cc0
PDBsum	5cc0
PubMed	26715749
UniProt	P06401\|PRGR_HUMAN Progesterone receptor (Gene Name=PGR)

[Back to BioLiP]