Structure of PDB 5cbz Chain A Binding Site BS02

Receptor Information

>5cbz Chain A (length=73) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SKVCLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRLRKCLQAGMNLGA

Ligand information

>5cbz Chain D (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcagaacactctgttctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5cbz Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	G439 S440 R447 Y455 R470 K471 R477
Binding residue (residue number reindexed from 1)	G22 S23 R30 Y38 R53 K54 R60
Binding affinity	PDBbind-CN: Kd=0.106uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5cbz, PDBe:5cbz, PDBj:5cbz
PDBsum	5cbz
PubMed	26715749
UniProt	P04150\|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]