Structure of PDB 5c7c Chain A Binding Site BS02

Receptor Information

>5c7c Chain A (length=107) Species: 9606 (Homo sapiens)

MNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDK
VKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHS
LEECLVR

Ligand information

• Ligand ID: 4YC
• InChI: InChI=1S/C17H24ClN3O/c1-12-9-20(7-6-19-12)10-16(22)21-11-17(2,3)14-5-4-13(18)8-15(14)21/h4-5,8,12,19H,6-7,9-11H2,1-3H3/p+1/t12-/m1/s1
• InChIKey: NUUUULZSGGTOOQ-GFCCVEGCSA-O
• SMILES:
  OpenEye OEToolkits 1.9.2: CC1CN(CC[NH2+]1)CC(=O)N2CC(c3c2cc(cc3)Cl)(C)C
  CACTVS 3.385: C[C@@H]1CN(CC[NH2+]1)CC(=O)N2CC(C)(C)c3ccc(Cl)cc23
  OpenEye OEToolkits 1.9.2: C[C@@H]1CN(CC[NH2+]1)CC(=O)N2CC(c3c2cc(cc3)Cl)(C)C
  CACTVS 3.385: C[CH]1CN(CC[NH2+]1)CC(=O)N2CC(C)(C)c3ccc(Cl)cc23
  ACDLabs 12.01: CC1[NH2+]CCN(C1)CC(=O)N2c3c(C(C2)(C)C)ccc(Cl)c3
• Formula: C17 H25 Cl N3 O
• Name: (2R)-4-[2-(6-chloro-3,3-dimethyl-2,3-dihydro-1H-indol-1-yl)-2-oxoethyl]-2-methylpiperazin-1-ium
• PDB chain: 5c7c Chain A Residue 402

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5c7c Fragment-Based Drug Discovery Targeting Inhibitor of Apoptosis Proteins: Discovery of a Non-Alanine Lead Series with Dual Activity Against cIAP1 and XIAP.
• Resolution: 2.32 Å
• Binding residue (original residue number in PDB): K297 G306 T308 D309 W310 E314 Q319 W323
• Binding residue (residue number reindexed from 1): K50 G59 T61 D62 W63 E67 Q72 W76
• Annotation score: 1
• Binding affinity: MOAD: ic50=5.5uM
  PDBbind-CN: -logKd/Ki=5.26,IC50=5.5uM

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

External links

• PDB: RCSB:5c7c, PDBe:5c7c, PDBj:5c7c
• PDBsum: 5c7c
• PubMed: 26218264
• UniProt: P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP)