Structure of PDB 5c13 Chain A Binding Site BS02

Receptor Information
>5c13 Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPE
EMQWFCPKC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c13 Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
Resolution2.101 Å
Binding residue
(original residue number in PDB)
M856 Y857 V858 I859 R860 E862
Binding residue
(residue number reindexed from 1)
M1 Y2 V3 I4 R5 E7
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5c13, PDBe:5c13, PDBj:5c13
PDBsum5c13
PubMed
UniProtQ5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subunit 3 (Gene Name=TAF3)

[Back to BioLiP]