Structure of PDB 5byg Chain A Binding Site BS02

Receptor Information
>5byg Chain A (length=181) Species: 648242 (Adeno-associated virus 2 Srivastava/1982) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPGFYEIVIKVPSEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRV
SKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRI
YRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNFLLPKTQPELQWAWT
NMEQYLSACLNLTERKRLVAQHLTHVSQTQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5byg Structural Insights into the Assembly of the Adeno-associated Virus Type 2 Rep68 Protein on the Integration Site AAVS1.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
S102 M103 G106 K136 G142 G143 G144 N145
Binding residue
(residue number reindexed from 1)
S82 M83 G86 K116 G122 G123 G124 N125
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5byg, PDBe:5byg, PDBj:5byg
PDBsum5byg
PubMed26370092
UniProtQ89268|REP78_AAV2S Protein Rep78 (Gene Name=Rep78)

[Back to BioLiP]