Structure of PDB 5brm Chain A Binding Site BS02

Receptor Information
>5brm Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGT
NIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPFPKNFMSVAKTILKRLFR
VYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQEL
IEKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5brm Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
Resolution2.651 Å
Binding residue
(original residue number in PDB)
V62 N66 N69 Y72 D116 Q123 L126 D127
Binding residue
(residue number reindexed from 1)
V11 N15 N18 Y21 D65 Q72 L75 D76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5brm, PDBe:5brm, PDBj:5brm
PDBsum5brm
PubMed26108669
UniProtQ9H8S9|MOB1A_HUMAN MOB kinase activator 1A (Gene Name=MOB1A)

[Back to BioLiP]