Structure of PDB 5aum Chain A Binding Site BS02

Receptor Information
>5aum Chain A (length=209) Species: 10114 (Rattus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVQLVESGGGLVQPKESLKISCAAFGVTFSNVAMYWVRQAPGKGLEWVAR
IRTKPNNYATYYADSVKGRFTISRDDSKSMVYLQMDNLKTEDTAMYYCTA
EVATDWGQGVMVTVSSAETTAPSVYPLAPSMVTLGCLVKGYFPEPVTVTW
NSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWSSQAVTCNVAHPASST
KVDKKIIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aum Crystal structure of a Fab fragment with the ligand peptide
Resolution2.05 Å
Binding residue
(original residue number in PDB)		V27 F29 N31 V32 A33 R52 T52A N53 E95 V96 T101 D102
Binding residue
(residue number reindexed from 1)		V27 F29 N31 V32 A33 R52 T53 N56 E101 V102 T104 D105
External links