Structure of PDB 5akn Chain A Binding Site BS02

Receptor Information

>5akn Chain A (length=178) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITAKSENLIKQHIAPL
MQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMRE
QIAFIKGLYVAEGDMTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDD
HRHGVYVLNISLRDRIKFVHTILSSHLN

Ligand information

>5akn Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttccggcgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5akn Engineering a Nickase on the Homing Endonuclease I-Dmoi Scaffold.
Resolution	2.75 Å
Binding residue (original residue number in PDB)	G20 D21 G22 Y25 Y29 K30 R33 R77
Binding residue (residue number reindexed from 1)	G15 D16 G17 Y20 Y24 K25 R28 R72

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing
GO:0016539	intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5akn, PDBe:5akn, PDBj:5akn
PDBsum	5akn
PubMed	26045557
UniProt	P21505\|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]