Structure of PDB 5a5j Chain A Binding Site BS02

Receptor Information

>5a5j Chain A (length=455) Species: 9606 (Homo sapiens)

RGKLPPGPTPLPLQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGY
EAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMT
LRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIPIIDYFPGTHNKLLKNV
AFMKSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESL
ENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSP
CMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTI
LISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFKKSKYFMPFSAGKRICVG
EALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCF
IPIHH

Ligand information

• Ligand ID: 6YF
• InChI: InChI=1S/C16H12ClF3N2O5S/c1-25-13-5-10(22-28(23,24)16(18,19)20)6-14(26-2)15(13)27-11-4-3-9(8-21)12(17)7-11/h3-7,22H,1-2H3
• InChIKey: LUIIPCXBEHYHFN-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.385: COc1cc(N[S](=O)(=O)C(F)(F)F)cc(OC)c1Oc2ccc(C#N)c(Cl)c2
  OpenEye OEToolkits 1.7.6: COc1cc(cc(c1Oc2ccc(c(c2)Cl)C#N)OC)NS(=O)(=O)C(F)(F)F
• Formula: C16 H12 Cl F3 N2 O5 S
• Name: N-[4-(3-chloranyl-4-cyano-phenoxy)-3,5-dimethoxy-phenyl]-1,1,1-tris(fluoranyl)methanesulfonamide
• ChEMBL: CHEMBL3818248
• ZINC: ZINC000584905086
• PDB chain: 5a5j Chain A Residue 1494

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5a5j Discovery of a Novel Binding Pocket for Cyp 2C9 Inhibitors: Crystallography, Pharmacophore Modelling and Inhibitor Sar.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): R108 I205 S209 G296 E300 T304 F476
• Binding residue (residue number reindexed from 1): R78 I175 S179 G259 E263 T267 F439
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): T301 F428 C435
• Catalytic site (residue number reindexed from 1): T264 F391 C398
• Enzyme Commision number: 1.14.14.1: unspecific monooxygenase.
  1.14.14.51: (S)-limonene 6-monooxygenase.
  1.14.14.52: (S)-limonene 7-monooxygenase.
  1.14.14.53: (R)-limonene 6-monooxygenase.

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0008392 arachidonate epoxygenase activity
• GO:0008395 steroid hydroxylase activity
• GO:0008404 arachidonate 14,15-epoxygenase activity
• GO:0008405 arachidonate 11,12-epoxygenase activity
• GO:0016491 oxidoreductase activity
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
• GO:0018675 (S)-limonene 6-monooxygenase activity
• GO:0018676 (S)-limonene 7-monooxygenase activity
• GO:0020037 heme binding
• GO:0034875 caffeine oxidase activity
• GO:0046872 metal ion binding
• GO:0052741 (R)-limonene 6-monooxygenase activity
• GO:0070330 aromatase activity

Biological Process

• GO:0006805 xenobiotic metabolic process
• GO:0008202 steroid metabolic process
• GO:0008203 cholesterol metabolic process
• GO:0008210 estrogen metabolic process
• GO:0016098 monoterpenoid metabolic process
• GO:0019369 arachidonate metabolic process
• GO:0019373 epoxygenase P450 pathway
• GO:0019627 urea metabolic process
• GO:0032787 monocarboxylic acid metabolic process
• GO:0042178 xenobiotic catabolic process
• GO:0042759 long-chain fatty acid biosynthetic process
• GO:0043603 amide metabolic process
• GO:0046456 icosanoid biosynthetic process
• GO:0070989 oxidative demethylation
• GO:0097267 omega-hydroxylase P450 pathway

Cellular Component

• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:5a5j, PDBe:5a5j, PDBj:5a5j
• PDBsum: 5a5j
• UniProt: P11712|CP2C9_HUMAN Cytochrome P450 2C9 (Gene Name=CYP2C9)