Structure of PDB 4zm0 Chain A Binding Site BS02

Receptor Information
>4zm0 Chain A (length=55) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKA
ALDAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zm0 An intrinsically disordered entropic switch determines allostery in Phd-Doc regulation.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		F6 R7 R10 R30 R31 R33
Binding residue
(residue number reindexed from 1)		F6 R7 R10 R30 R31 R33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0097351 toxin sequestering activity
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4zm0, PDBe:4zm0, PDBj:4zm0
PDBsum4zm0
PubMed27159580
UniProtQ06253|PHD_BPP1 Antitoxin phd (Gene Name=phd)

[Back to BioLiP]