Structure of PDB 4z9v Chain A Binding Site BS02

Receptor Information
>4z9v Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRK
GQE
Ligand information
>4z9v Chain E (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEMFSDIYKIREIADGLCLEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z9v TCTP contains a BH3-like domain, which instead of inhibiting, activates Bcl-xL.
Resolution2.099 Å
Binding residue
(original residue number in PDB)		V155 Q160 S164 R165
Binding residue
(residue number reindexed from 1)		V100 Q105 S109 R110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4z9v, PDBe:4z9v, PDBj:4z9v
PDBsum4z9v
PubMed26813996
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]