Structure of PDB 4z3a Chain A Binding Site BS02

Receptor Information
>4z3a Chain A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPG
PGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLS
SKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGL
QPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z3a Thymine DNA glycosylase exhibits negligible affinity for nucleobases that it removes from DNA.
Resolution1.72 Å
Binding residue
(original residue number in PDB)		G105 N140 N157 G199 S200 K201 G231 K232 C233 S271 S273 A274 R275 C276 A277 Q278
Binding residue
(residue number reindexed from 1)		G1 N36 N53 G95 S96 K97 G127 K128 C129 S167 S169 A170 R171 C172 A173 Q174
Enzymatic activity
Catalytic site (original residue number in PDB) N140 H151
Catalytic site (residue number reindexed from 1) N36 H47
Enzyme Commision number 3.2.2.29: thymine-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0000700 mismatch base pair DNA N-glycosylase activity
Biological Process
GO:0006285 base-excision repair, AP site formation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4z3a, PDBe:4z3a, PDBj:4z3a
PDBsum4z3a
PubMed26358812
UniProtQ13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)

[Back to BioLiP]