Structure of PDB 4yoq Chain A Binding Site BS02

Receptor Information

>4yoq Chain A (length=344) Species: 1422 (Geobacillus stearothermophilus)

PAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYF
EQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGG
KVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVT
DDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLC
PVQAYCQAFAEGVAEELPVKMVKQVPLAVAVLADDEGRVLIRKRDSTGLL
ANLWEFPSCETDGADGKEKLEQMVGLQVELTEPIVSFEHAFSHLVWQLTV
FPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS

Ligand information

>4yoq Chain C (length=10)

gtccacgtct

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4yoq Structural Basis for Avoidance of Promutagenic DNA Repair by MutY Adenine DNA Glycosylase.
• Resolution: 2.21 Å
• Binding residue (original residue number in PDB): Q47 Q48 R50 G122 G124 P125 Y126 T127 D144 G145 M148 R149 I161 C164 R167 K228
• Binding residue (residue number reindexed from 1): Q39 Q40 R42 G114 G116 P117 Y118 T119 D136 G137 M140 R141 I153 C156 R159 K220

Enzymatic activity

• Catalytic site (original residue number in PDB): E43 Y126 D144
• Catalytic site (residue number reindexed from 1): E35 Y118 D136
• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Gene Ontology

Molecular Function

• GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0032357 oxidized purine DNA binding
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0035485 adenine/guanine mispair binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006298 mismatch repair
• GO:0006950 response to stress

External links

• PDB: RCSB:4yoq, PDBe:4yoq, PDBj:4yoq
• PDBsum: 4yoq
• PubMed: 25995449
• UniProt: P83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)